X-Git-Url: http://105106.c2e0p.group/dotfiles.git/blobdiff_plain/7db6359521ae4d3e6435fe23e097c23926a9ef5f..10f7a98c1e9de39a3b8f3ab18cf63d2c3a62b082:/vimrc?ds=inline

diff --git a/vimrc b/vimrc
index d27a4df..1c5b642 100644
--- a/vimrc
+++ b/vimrc
@@ -1,1573 +1,110 @@
-version 5.3
-" ==================================================================
-" File:         $HOME/.vimrc
-" Availability: This file is available as
-"   ~20K        <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc.gz>
-"   ~56K        <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc>
-"               <URL:http://www.vim.org/rc> (mirror)
-" Size:         This file is about 57K in size and has 1,500+ lines.
-" Purpose:      Setup file for the editor Vim (Vi IMproved)
-" Author:       Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de)
-"               <URL:http://www.math.fu-berlin.de/~guckes/sven/>
-" Related files:
-"               http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim
-"               http://www.math.fu-berlin.de/~guckes/vim/src/html.vim
-"               http://www.math.fu-berlin.de/~guckes/vim/syntax/
-" Note:         Please send comments to me - email preferred! :-)
-" Last update:  Thu Dec 10 02:02:02 CET 1998
-" ===================================================================
-" The latest versions of Vim are usually in my signature file:
-" http://www.math.fu-berlin.de/~guckes/sig/SIGS  Have a look!
-" ===================================================================
-" Note to Windows users:  Get these files from any Vim mirror:
-"     vim52rt.zip (840K)  vim runtime files (docs + syntax files)
-"     gvimw32.zip (440K)  gvim - precompiled binary for Windows 32bit
-" These should fit onto one floppy.  Just a recommendation.
-" ===================================================================
-" Installation of this setup file:
-"
-"  To use this setup file, copy it to
-"  this filename    on these systems:
-"    ~/.vimrc       Unix and OS/2
-"    s:.vimrc       Amiga
-"    $VIM\_vimrc    MS-DOS and Win32
-"
-" NOTE: This setup file uses a lot of features of Vim-5.
-" If you are still using Vim-4 (or an even older version)
-" then you should upgrade - it is really worth the effort!
-" To find out why get Vim-5 and read ":help version5".
-"
-" The first line of this setup file contains the information
-" "version xxx" which allows VIM to check whether the setup file
-" fits the syntax that it understands.
-" Versions of VIM other than of version 5 then will give a warning
-" as they do not understand this setup file command - a feature:
-" Give a warning so the user knows that there is something odd
-" about the setup file.
-" ===================================================================
-" Whitespace meta sequence:
-" vim-5.0s introduced the meta sequence "\s" which stands for "whitespace"
-" ie either a space or a tab.  This makes mappings a lot easier.
-" I have therefore updated my mappings to use this sequence.
-" But this is incompatible with previous versions and, of course, Vi.
-" ===================================================================
-" Info on the latest versions is on the Vim HomePage:
-"       http://www.vim.org/ - which is a daily mirror of the pages at
-"       http://www.math.fu-berlin.de/~guckes/vim/
-" and in Sven's signature file:
-" http://www.math.fu-berlin.de/~guckes/sig/SIGS
-" ===================================================================
-" ===================================================================
-" Structure of this file:
-" Lines starting with an inverted comma (") are comments.
-" Some mappings are commented out.  Remove the comment to enable them.
-"
-" There are three kinds of things which are defined in this file:
-" Mapping ("map"), settings ("set"), and abbreviations ("ab").
-"   Settings affect the behaviour of commands.
-"   Mappings maps a key sequence to a command.
-"   Abbreviations define words which are replaced
-"   right *after* they are typed in.
-"
-" ===================================================================
-" Note on mappings - "angle notation" (see ":help <>"):
-" VIM allows you to define mappings with special characters
-" with a notation that uses non-special characters:
-" The notation encloses decriptive words in angle brackets (<>).
-" The characters you will most often are:
-" <C-M> for control-m
-" <C-V> for control-v which quotes the following character
-" <ESC> for the escape character.
-" All control characters have been replaced to use the angle notation
-" so you should be able to read this file without problems.
-" (Well, sometimes I leave some tabs [control-i] in the file. ;-)
-" ===================================================================
-" External programs:
-" Some mappings make use of external programs.
-" The following you should find on every UNIX system:
-" awk, egrep, grep, ispell, perl, sed.
-" If you are using DOS then you should get these for you system!!
-" Programs that are supplied with the mailer ELM: elmalias, readmsg.
-" To get these look at page
-" http://www.math.fu-berlin.de/~guckes/elm/dist.html
-" One major advantage of vim-5 (actually, 5.0g) is that there is now
-" the internal function "strftime".  This allows to insert the current
-" date and time in various format.  Example:  mapping ",L" (see below)
-" ===================================================================
-" SETtings
-" ===================================================================
-"
-"       autoindent:  "off" as I usually do not write code.
-  set noautoindent
-"
-"       autowrite: "on" saves a lot of trouble
-  set   autowrite
-"
-"       backup:  backups are for wimps  ;-)
-  set nobackup
-"
-"       backspace:  '2' is much smarter.
-  set   backspace=2
-"
-"       background:  Are we using a "light" or "dark" background?
- set   background=dark
-"
-"       compatible  ....
-  set nocompatible
-"
-"       comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:-
-  set   comments=b:#,:%,fb:-,n:>,n:)
-"
-"       cpoptions you should get to know - source of many FAQs!  ;-)
-"       cpoptions:  "compatible options" to match Vi behaviour
-" set   cpoptions="aABceFs"   "default!
-"       FAQ:  Do NOT include the flag '<' if you WANT angle notation!
-"
-"       dictionary: english words first
-  set   dictionary=/usr/dict/words,/local/lib/german.words
-"
-"       digraph:    required for those umlauts
-  set   digraph
-"
-"       errorbells: damn this beep!  ;-)
-  set noerrorbells
+" Use Vim settings, rather then Vi settings (much better!).
+" This must be first, because it changes other options as a side effect.
+set nocompatible
 
-"       esckeys:    allow usage of cursor keys within insert mode
-  set   esckeys
-"
-"       formatoptions:  Options for the "text format" command ("gq")
-"                       I need all those options (but 'o')!
-  set   formatoptions=cqrt
-"
-"       helpheight: zero disables this.
-  set   helpheight=0
-"
-"       helpfile:  filename of the helpfile
-" set   helpfile=c:\\vim-4.6\\docs\\help.txt
-"       this is where I usually put it on DOS; sometimes is required
-"       to set as the default installation does not find it  :-(
-"
-"       hidden:
-  set   hidden
-"
-"       highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws
-  set   highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws
-"
-"       hlsearch :  highlight search - show the current search pattern
-"       This is a nice feature sometimes - but it sure can get in the
-"       way sometimes when you edit.
-  set nohlsearch
-"
-"       icon:       ...
-  set noicon
-"
-" set   iconstring  file of icon (Sven doesn't use an icon)
-" set   iconstring
-"
-"       ignorecase:  ignore the case in search patterns?  NO!
-  set noignorecase
-"
-"       insertmode:  start in insert mode?  Naah.
-  set noinsertmode
-"
-"
-"       iskeyword:  Add the dash ('-'), the dot ('.'), and the '@'
-"                   as "letters" to "words".
-"       iskeyword=@,48-57,_,192-255   (default)
-  set   iskeyword=@,48-57,_,192-255,-,.,@-@
-"
-"       joinspaces:  insert two spaces after a period with every
-"                joining of lines.  This is very nice!
-  set   joinspaces
-"
-"       keywordprg:  Program to use for the "K" command.
-" set   keywordprg=man\ -s
-"
-"       laststatus:  show status line?  Yes, always!
-"       laststatus:  Even for only one buffer.
-  set   laststatus=2
-"
-" [VIM5]lazyredraw:  do not update screen while executing macros
-  set   lazyredraw
-"
-"       magic:       use some magic in search patterns?  Certainly!
-  set   magic
-"
-"       modeline:    ...
-"       Allow the last line to be a modeline - useful when
-"       the last line in sig gives the preferred textwidth for replies.
-  set   modeline
-  set   modelines=1
-"
-"       number:      ...
-  set nonumber
-"
-"       path:   The list of directories to search when you specify
-"               a file with an edit command.
-"               Note:  "~/.P" is a symlink to my dir with www pages
-"               "$VIM/syntax" is where the syntax files are.
-  set   path=.,,~/.P/vim,~/.P/vim/syntax,~/.P/vim/source,$VIM/syntax/
-" set   path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn
-"
-"       report: show a report when N lines were changed.
-"               report=0 thus means "show all changes"!
-  set   report=0
-"
-"       ruler:       show cursor position?  Yep!
-  set   ruler
-"
-" Setting the "shell" is always tricky - especially when you are
-" trying to use the same vimrc on different operatin systems.
-"       shell for DOS
-" set   shell=command.com
-"       shell for UNIX -  math.fu-berlin.de BSD
-" set   shell=zsh
-"       shell for UNIX -   inf.fu-berlin.de BSD&Solaris
-" set   shell=zsh
-"       shell for UNIX - zedat.fu-berlin.de BSD&Solaris
-" set   shell=/bin/tcsh
-"       zsh now available at zedat!  :-)
-" set   shell=zsh
-" Now that vim-5 has ":if" I am trying to automate the setting:
-"
-  if has("dos16") || has("dos32")
-  let shell='command.com'
-  endif
-  if has("unix")
-  let shell='zsh'
-  endif
-"
-"       shiftwidth:  Number of spaces to use for each
-"                    insertion of (auto)indent.
-  set   shiftwidth=8
-"
-"       shortmess:   Kind of messages to show.   Abbreviate them all!
-"          New since vim-5.0v: flag 'I' to suppress "intro message".
-  set   shortmess=at
-"
-"       showcmd:     Show current uncompleted command?  Absolutely!
-  set   showcmd
-"
-"       showmatch:   Show the matching bracket for the last ')'?
-  set   showmatch
-"
-"       showmode:    Show the current mode?  YEEEEEEEEESSSSSSSSSSS!
-  set   showmode
-"
-"       suffixes:    Ignore filename with any of these suffixes
-"                    when using the ":edit" command.
-"                    Most of these are files created by LaTeX.
-  set   suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar
-"
-"       startofline:  no:  do not jump to first character with page
-"       commands, ie keep the cursor in the current column.
-  set nostartofline
-"
-"       tabstop
-  set   tabstop=8
-"
-"
-" Set the colors for vim on "xterm"
-  if &term=="xterm"
-    set t_Co=8          " "terminal has eight colors"
-    set t_Sb=[4%dm    " escape sequence for background
-    set t_Sf=[3%dm    " escape sequence for foreground
-"   source ~/.P/vim/syntax/colors.vim
-"   http://www.math.fu-berlin.de/~guckes/vim/syntax/colors.vim
-" [todo] Add this to the Vim FAQ
-  endif
-"
-"       textmode:    no - I am using Vim on UNIX!
-  set notextmode
-"
-"       textwidth
-  set   textwidth=79
-"
-"       title:
-  set notitle
-"
-"       ttyfast:     are we using a fast terminal?
-"                    seting depends on where I use Vim...
-  set nottyfast
-"
-"       ttybuiltin:
-  set nottybuiltin
-"
-"       ttyscroll:      turn off scrolling -> faster!
-  set   ttyscroll=0
-"
-"       ttytype:
-" set   ttytype=rxvt
-"
-"       viminfo:  What info to store from an editing session
-"                 in the viminfo file;  can be used at next session.
-  set   viminfo=%,'50,\"100,:100,n~/.viminfo
-"
-"       visualbell:
-  set   visualbell
-"
-"       t_vb:  terminal's visual bell - turned off to make Vim quiet!
-"       Please use this as to not annoy cow-orkers in the same room.
-"       Thankyou!  :-)
-  set   t_vb=
-"
-"       whichwrap:
-  set   whichwrap=<,>
-"
-"       wildchar  the char used for "expansion" on the command line
-"                 default value is "<C-E>" but I prefer the tab key:
-  set   wildchar=<TAB>
-"
-"       wrapmargin:
-  set   wrapmargin=1
-"
-"       writebackup:
-  set nowritebackup
-"
-" ===================================================================
-" ABbreviations
-" ===================================================================
-" 980701: Moved the abbreviations *before* the mappings as
-" some of the abbreviations get used with some mappings.
-"
-" Abbreviations for some important numbers:
-  iab Npi 3.1415926535897932384626433832795028841972
-  iab Ne  2.7182818284590452353602874713526624977573
-"
-" Abbreviations for some classic long words:
-"
-"     Donau... is the German word for the (read in reverse)
-"     "additional paragraph of the law regulating the pension of
-"      widows to captains of the ship company on (the river) Danube"
-"     (I am not making this up! ;-)
-  iab YDD Donaudampfschiffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph
-"
-"     YLL : The name of a town in Wales.  I am not making this up!
-  iab YLL    LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
-" http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk
-" http://194.159.85.168/ - I am not making this up!  :-)
-"
-"     YTauma: The name of a hill in New Zealand.
-  iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu
-"
-"     Yalpha : The lower letter alphabet.
-  iab Yalpha abcdefghijklmnopqrstuvwxyz
-"
-"     YALPHA : The upper letter alphabet.
-  iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ
-"
-"     Ydigit : The ten digits.
-  iab Ydigit 1234567890
-"
-"     Yruler : A ruler.
-  iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
-"
-"     Yupsidedown : This describes people from "down under"
-"                   (Hi, Dean!).
-  iab Yupsidedown umop-ap!sdn
-"
-"     Ysuper: A nice long word from the musical "Mary Poppins".
-  iab Ysuper supercalifragilisticexpialidocious
+" TODO: this may not be in the correct place. It is intended to allow overriding <Leader>.
+" source ~/.vimrc.before if it exists.
+if filereadable(expand("~/.vimrc.before"))
+  source ~/.vimrc.before
+endif
 
-"     Yanti:  The longest proper word in the English language?!
-  iab Yanti antidisestablishmentarianism
-"
-"     Ypass : Standard answer to Usenet posts
-"             with the "Subject: HELP"  (hehe)
-  iab Ypass "You are in a maze of twisty little passages, all alike."
-"
-"     Ysesqui : "Sesquipedalophobia" means "fear of big words."  ;-)
-  iab Ysesqui    sesquipedalophobia
-"
-" classic pangrams (which include every letter of the alphabet):
-" German:
-"   sylvia wagt quick den jux bei pforzheim
-"   bayerische jagdwitze von maxl querkopf
-"   zwei boxkaempfer jagen eva quer durch sylt
-"   kaufen sie jede woche vier gute bequeme pelze
-"   falsches üben von xylophonmusik quält jeden größeren zwerg.
-"   Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch!
-" English:
-"        the quick brown fox jumps over the lazy dog
-" French:
-"        voyez le brick geant que j'examine pres du wharf.
-"
-"       And a sentence to break some quoing levels:
-"       "This man's house (which 's yellow) burned down."
-"
-"       And now for something completely different:
-"       I couldn't bear to bear bears over the border.
-"
-" Inserting an ellipsis to indicate deleted text
-  iab  Yell  [...]
-  vmap ,ell c[...]<ESC>
-"
-" Correcting those typos. [I almost never get these right.  :-(]
-" See also:  http://www.igd.fhg.de/~zach/programs/acl/
-  iab alos also
-  iab aslo also
-  iab charcter character
-  iab charcters characters
-  iab exmaple example
-  iab shoudl should
-  iab seperate separate
-  iab teh the
-" Some frequent typos in German:
-  iab nciht nicht
-  iab doer oder
-  iab Dreckfuhler Druckfehler
-" Sorry, Laurent!
-  iab Laurant Laurent
-"
-" See http://www.math.fu-berlin.de/~guckes/sig/:
-  iab YDDS dash-dash-space
-"
-" For reports and texts on my studies:
-  iab YKT Komplexitaetstheorie
-  iab YRA Rechnerarchitektur
-  iab YPM Pattern Matching
-" see http://elib.zib.de/ICM98 :
-  iab YICM International Congress of Mathematicians
-"
-" Some sentences that I really use often in emails about Vim:
-  iab YAW You are welcome!  :-)
-  iab YEV Enjoy Vim!
-"
-" Often used filenames - only needed these on the command line:
-" see also:  http://www.math.fu-berlin.de/~guckes/setup/
-"
-  cab ELMALIAS  ~/.elm/aliases.text
-  cab Erc       ~/.elm/elmrc
-  cab Mrc       ~/.muttrc
-  cab Src       ~/.slrnrc
-  cab Zrc       ~/.zsh/.zshrc
-  cab SIGs      ~/.P/sig/SIGS
-"
-" A list of filenames that are needed to shorten some autocommands:
-" cab MAILNEWSFILES .article,.followup,.letter,mutt*[0-9],/postpone/*
-" cab MAILNEWSFILES *.article,*.followup,*.letter,*mutt*
-let MAILNEWSFILES = "*.article,*.followup,*.letter,mutt*"
-"
-" see also:  http://www.math.fu-berlin.de/~guckes/sig/SIGS
-"
-"  Email Adresses:
-"  I usually use these when adding addresses to the header
-"  of emails (mutt) and posts (slrn).
-"
-"             Author of the Good NetKeeping Seal of Approval:
-  ab Agnksa   js@xs4all.nl (Jeroen Scheerder)
-"
-"             Author of Mutt:
-  ab Amutt    me@cs.hmc.edu (Michael Elkins)
-"
-"             Author of Slrn:
-  ab Aslrn    davis@space.mit.edu (John E. Davis)
-"
-"             Author of Vim:
-" ab Avim     mool@oce.nl (Bram Moolenaar)
-  ab Avim     bram@vim.org (Bram Moolenaar)
-"
-"             Former Maintainer of the Vim FAQ:
-  ab Avimfaq  laurent@Grafnetix.COM (Laurent Duperval)
-"
-"    Mailing Lists (MLs)
-"
-"    The Vim mailing lists: See http://www.vim.org/mail.html for more info!
-  ab MLvim      vim@vim.org (VIM Help List)
-  ab MLvimdev   vim-dev@vim.org (VIM Development List)
-  ab MLvimmac   guckes-vimmac@math.fu-berlin.de (VIM on MacOS Development List)
-"
-" More mailing lists:
-  ab MLgnksa    gnksa-workers@babayaga.math.fu-berlin.de (GNKSA Workers List)
-  ab MLmuttdev  mutt-dev@mutt.org (Mutt Developer List)
-  ab MLmuttuser mutt-users@mutt.org (Mutt Users List)   
-  ab MLzsh      zsh-users@math.gatech.edu (ZShell Users List)
-"
-"
-"   News: newsgroup names
-"
-" Newsgroup about "warloding" of signatures - see
-" also http://www.math.fu-berlin.de/~guckes/afw/
-  iab Nafw    alt.fan.warlord
-  iab Nahbou  alt.humor.best-of-usenet
-  iab Nzedat  bln.announce.fub.zedat.d
-  iab Ncsd    bln.announce.fub.cs.d
-  iab Nce     comp.editors
-" Newsgroup about "lynx":
-  iab Nhtml   comp.infosystems.www.authoring.html
-" Newsgroup about "elm":  Elm is dead - long live Mutt!
-  iab Nelm    comp.mail.elm
-" Newsgroup about "pine":  When will they release pine-4?
-" iab Ncmp    comp.mail.pine
-  iab Npine   comp.mail.pine
-" iab Ncsmd   comp.sys.mac.digest
-" Newsgroup about "mobil phone systems":
-  iab Ndcm    de.comm.mobil
-  iab Nmobil  de.comm.mobil
-" Newsgroup about "web browsers":
-  iab Nlynx     comp.infosystems.www.browsers.misc
-  iab Nnetscape comp.infosystems.www.browsers.misc
-" Newsgroup about "mutt" [since 980401]:  The coolest mail user agent
-  iab Nmutt   comp.mail.mutt
-" Newsgroup about "nn":  Once was the best newsreader. Still good.
-  iab Nnn     news.software.nn
-" Newsgroup for "newbies".
-" All you ever wanted to know - but were afraid to ask. ;-)
-  iab Newbie  news.newusers.questions
-" Newsgroup about "newsreader *agents*" (netscape and slrn):
-  iab Nnsr    news.software.readers
-"
-" Usenet header lines (used when composing a post):
-"
-  iab UFT  Followup-To:
-  iab UMCT Mail-Copies-To: MYADDR
-  iab UNG  Newsgroups:
-  iab URT  Reply-To: MYADDR
-  iab UFUB Organization: Freie Universitaet Berlin
-"
-" Current version numbers of my favourite programs:
-" http://www.math.fu-berlin.de/~guckes/sig/SIGS
-" And some abbreviations to type them in mail&news:
-"
-  iab Velm  ELM2.4PL25 [951204]
-  iab VElm  ELM2.5b2 [980213]
-  iab Vlynx lynx-2.8.0 [980310
-  iab Vmutt mutt-0.92.8 [980514]
-  iab Vslrn slrn-0.9.5.2 [980503]
-  iab Vvim  vim-5.1  [980407]
-  iab Vvimdev vim-5.2c [980518]
-"
-" For current version numbers take a look at my signature file:
-" http://www.math.fu-berlin.de/~guckes/sig/SIGS
-"
-"  My snail mail address, phone numbers, and email->pager gateway:
-"  Postcards and FAXes are welcome (especially with cartoons :-).
-"  If you want, you can send a message to my pager by email, too.
-  iab Ypager To: ums@teco.edu<C-M>Subject: PAGE:01777777796
-  iab Yphone TEL/FAX   (+49  30) 8838884<C-M>Cellphone (+49 177) 7777796
-  iab Ysnail Sven Guckes<C-M>Pariser Str. 52<C-M>D-10719 Berlin
-"
-"  My addresses (Email and WWW)
-"  makes it easy to type them without typos  ;-)
-  ab Amaili guckes@inf.fu-berlin.de
-  ab Amailm guckes@math.fu-berlin.de
-  ab Amailv guckes@vim.org
-  ab Amailz guckes@zedat.fu-berlin.de
-  ab MYADDR guckes@math.fu-berlin.de
-  ab MYNAME Sven Guckes
-"
-" Setting the reply address when replying as the guy from SKB:
-  ab ASKB   Sprachboerse <sprachboerse@tu-berlin.de>
-" See also: http://www.math.fu-berlin.de/~guckes/skb/
-"
-"  My Home Pages at the departments at the FUB
-"
-  ab WWWm   http://www.math.fu-berlin.de/~guckes/
-  ab WWWi   http://www.inf.fu-berlin.de/~guckes/
-  ab WWWz   http://userpage.zedat.fu-berlin.de/~guckes/
-"
-" WWW Pages base URLs
-"
-  ab HPA   http://www.math.fu-berlin.de/~guckes/afw/
-  ab HPa   http://www.math.fu-berlin.de/~guckes/ascii/
-  ab HPc   http://www.math.fu-berlin.de/~guckes/calvin/
-  ab HPD   http://www.math.fu-berlin.de/~guckes/dos/
-  ab HPe   http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html
-  ab HPE   http://www.math.fu-berlin.de/~guckes/elm/
-  ab HPI   http://www.math.fu-berlin.de/~guckes/irc/
-  ab HPi   http://www.math.fu-berlin.de/~guckes/ispell/
-  ab HPL   http://www.math.fu-berlin.de/~guckes/lynx/
-  ab HPl   http://www.math.fu-berlin.de/~guckes/less/
-  ab HPm   http://www.math.fu-berlin.de/~guckes/mail/
-  ab HPM   http://www.math.fu-berlin.de/~guckes/mutt/
-  ab HPN   http://www.math.fu-berlin.de/~guckes/nn/
-  ab HPP   http://www.math.fu-berlin.de/~guckes/pine/
-  ab HPp   http://www.math.fu-berlin.de/~guckes/procmail/
-  ab HPr   http://babayaga.math.fu-berlin.de/~rxvt/
-  ab HPR   http://www.math.fu-berlin.de/~guckes/rfc/
-  ab HPs   http://www.math.fu-berlin.de/~guckes/screen/
-  ab HPS   http://www.math.fu-berlin.de/~guckes/slrn/
-  ab HPv   http://www.math.fu-berlin.de/~guckes/vi/
-"    HPOV - the "original" URL of the Vim Home Page!
-  ab HPOV  http://www.math.fu-berlin.de/~guckes/vim/
-  ab HPV   http://www.vim.org/
-  ab HPX   http://www.math.fu-berlin.de/~guckes/xmas/
-  ab HPZ   http://www.math.fu-berlin.de/~guckes/zsh/
-"
-" Other important WWW addresses
-"
-  ab URLutefuchs  http://www.math.fu-berlin.de/~utefuchs/
-  ab URLaltavista http://altavista.digital.com/
-  ab URLftpsearch http://ftpsearch.ntnu.no/ftpsearch/
-  ab URLvimfaq    http://www.grafnetix.com/~laurent/vim/faq.html
-  ab URLbambi     http://www.math.fu-berlin.de/~leitner/CnH/bambi.html
-  ab URLsecret    http://www.math.fu-berlin.de/~leitner/CnH/secret.html
-  ab URLwhome     http://www.math.fu-berlin.de/~leitner/CnH/who.me.html
-  ab URLstopspam  http://www.math.fu-berlin.de/~guckes/pics/stop.this.spam.jpg
-  ab FTPFUB        ftp://ftp.fu-berlin.de/
-  ab FTPVIM        ftp://ftp.fu-berlin.de/pub/misc/editors/vim/
-"
-" ===================================================================
-" Abbreviations - Header Lines for Email and News
-" ===================================================================
-" Define regexpr for headers to use with mappings
-" as it makes reading the mappings much easier:
-" cab HADDR     From\\|Cc\\|To
-  cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\)
-  cab HNEWS  ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\)
-"
-" ===================================================================
-" Abbreviations - General Editing - Inserting Dates and Times
-" ===================================================================
-"
-" First, some command to add date stamps (with and without time).
-" I use these manually after a substantial change to a webpage.
-" [These abbreviations are used with the mapping for ",L".]
-"
-  iab Ydate <C-R>=strftime("%y%m%d")<CR>
-" Example: 971027
-"
-  iab Ytime <C-R>=strftime("%H:%M")<CR>
-" Example: 14:28
-"
-  iab YDT   <C-R>=strftime("%y%m%d %T")<CR>
-" Example: 971027 12:00:00
-"
-  iab YDATE <C-R>=strftime("%a %b %d %T %Z %Y")<CR>
-" Example: Tue Dec 16 12:07:00 CET 1997
-"
-" On Windows the functions "strftime" seems to have a different
-" format.  Therefore the following may be necessary:  [980730]
-" if !has("unix")
-" iab YDATE <C-R>=strftime("%c %a")<CR>
-" else
-" iab YDATE <C-R>=strftime("%D %T %a")<CR>
-" endif
-"
-" ===================================================================
-" MAPpings
-" ===================================================================
-" Caveat:  Mapping must be "prefix free", ie no mapping must be the
-" prefix of any other mapping.  Example:  "map ,abc foo" and
-" "map ,abcd bar" will give you the error message "Ambigous mapping".
-"
-" The backslash ('\') is the only(?) unmapped key, so this is the best
-" key to start mappings with as this does not take away a command key.
-" However, the backslash is never in the same position with keyboards.
-" Eg on German keyboards it is AltGr-sz - don't ask.
-" Anyway, I have decided to start mappings with the comma as this
-" character is always on the same position on almost all keyboards
-" and I hardly have a need for that command.
-"
-" The following maps get rid of some basic problems:
-"
-" With Vim-4 the format command was just 'Q' and
-" I am too used to it.  So I need this back!
-  nnoremap Q gq
-  vnoremap Q gq
-"
-" 980527 I often reformat a paragraph to fit some textwidth -
-" and I use the following mapping to adjust it to the
-" current position of the cursor:
-  map #tw :set textwidth=<C-R>=col(".")<C-M>
-"
-" 981210 Whenever I paste some text into VIM I have to
-" toggle from "nopaste" to "paste" and back again:
-" map <f4>   :set paste!<c-m>:set paste?<c-m>
-  map <esc>[14~ :set paste!<c-m>:set paste?<c-m>
-"
-" "tal" is the "trailer alignment" filter program
-" Hopefully it will ship with Vim one day.
-" vmap #t !tal<CR>
-" vmap #t !tal -p 0<CR>
-"
-" Disable the command 'K' (keyword lookup) by mapping it
-" to an "empty command".  (thanks, Lawrence! :-):
-" map K :<CR>
-  map K :<BS>
-"
-" Disable the suspend for ^Z.
-" I use Vim under "screen" where a suspend would lose the
-" connection to the " terminal - which is what I want to avoid.
-  map <C-Z> :shell
-"
-" Make CTRL-^ rebound to the *column* in the previous file
-  noremap <C-^> <C-^>`"
-"
-" Make "gf" rebound to last cursor position (line *and* column)
-  noremap gf gf`"
-"
-" When I let Vim write the current buffer I frequently mistype the
-" command ":w" as ":W" - so I have to remap it to correct this typo:
-  nmap :W :w
-"
-" Are you used to the Unix commands "alias" and "which"?
-" I sometimes use these to look up my abbreviations and mappings.
-" So I need them available on the command line:
-  map :alias map
-  map :which map
-"
-" The command {number}CTRL-G show the current nuffer number, too.
-" This is yet another feature that vi does not have.
-" As I always want to see the buffer number I map it to CTRL-G.
-" Pleae note that here we need to prevent a loop in the mapping by
-" using the comamnd "noremap"!
-  noremap <C-G> 2<C-G>
-"
-" 980311  Sourcing syntax files
-" My personal syntax files are in ~/.P/vim/syntax/
-" and I need a quick way to edit and source them.
-  map ,SO :so ~/.P/vim/syntax/
-"
-" 980706  Sourcing syntax files from the distribution
-" A nice and fast way to both source syntax files
-" and to take a look at "what's there":
-  map ,V  :so $VIM/syntax/
-"
-" ===================================================================
-" Customizing the command line
-" ===================================================================
-" Valid names for keys are:  <Up> <Down> <Left> <Right> <Home> <End>
-" <S-Left> <S-Right> <S-Up> <PageUp> <S-Down> <PageDown>  <LeftMouse>
-"
-" Many shells allow editing in "Emacs Style".
-" Although I love Vi, I am quite used to this kind of editing now.
-" So here it is - command line editing commands in emacs style:
-  cnoremap <C-A> <Home>
-  cnoremap <C-F> <Right>
-  cnoremap <C-B> <Left>
-" cnoremap <C-E> <End>
-  cnoremap <ESC>b <S-Left>
-  cnoremap <ESC>f <S-Right>
-  cnoremap <ESC><C-H> <C-W>
-"
-" Additional codes for that "English" keyboard at the Xterminal
-  cnoremap <ESC>[D <S-Left>
-  cnoremap <ESC>[C <S-Right>
-"
-" Some editing is helpful in insert mode, too:
-  inoremap <C-F> <Right>
-  inoremap <C-B> <Left>
-"
-" Make the up and down movements move by "display/screen lines":
-"      map j      gj
-"      map <Down> gj
-"      map k      gk
-"      map <Up>   gk
-"
-" ===================================================================
-" VIM - Editing and updating the vimrc:
-" As I often make changes to this file I use these commands
-" to start editing it and also update it:
-  if has("unix")
-    let vimrc='~/.vimrc'
-  else
-" ie:  if has("dos16") || has("dos32") || has("win32")
-    let vimrc='$VIM\_vimrc'
-  endif
-  nn  ,u :source <C-R>=vimrc<CR><CR>
-  nn  ,v :edit   <C-R>=vimrc<CR><CR>
-"     ,v = vimrc editing (edit this file)
-" map ,v :e ~/.vimrc<CR>
-"     ,u = "update" by reading this file
-" map ,u :source ~/.vimrc<CR>
-" ===================================================================
-"
-" General Editing
-"
-" Define "del" char to be the same backspace (saves a LOT of trouble!)
-" As the angle notation cannot be use with the LeftHandSide
-" with mappings you must type this in *literally*!
-  map <C-V>127 <C-H>
- cmap <C-V>127 <C-H>
-" the same for Linux Debian which uses 
- imap <Esc>[3~ <C-H>
- imap        <C-H>
-"
-"      ;rcm = remove "control-m"s - for those mails sent from DOS:
-  cmap ;rcm %s/<C-M>//g
-"
-"     Make whitespace visible:
-"     Sws = show whitespace
-  nmap ,Sws :%s/ /_/g<C-M>
-  vmap ,Sws :%s/ /_/g<C-M>
-"
-"     Sometimes you just want to *see* that trailing whitespace:
-"     Stws = show trailing whitespace
-  nmap ,Stws :%s/  *$/_/g<C-M>
-  vmap ,Stws :%s/  *$/_/g<C-M>
-"
-" General Editing - Turning umlauts into ascii (for German keyboards)
-"
-" imap ä ae
-" imap ö oe
-" imap ü ue
-" imap ß ss
-"
-" &#196; -> Ä  :%s/\&#196;/Ä/gc  -> D
-" &#214; -> Ö  :%s/\&#214;/Ö/gc  -> V
-" &#220; -> Ü  :%s/\&#220;/Ü/gc  -> \
-" &#228; -> ä  :%s/\&#228;/ä/gc  -> d
-" &#246; -> ö  :%s/\&#246;/ö/gc  -> v
-" &#252; -> ü  :%s/\&#252;/ü/gc  -> |
-"
-" ===================================================================
-" Inserting Dates and Times / Updating Date+Time Stamps
-" ===================================================================
-"     ,L  = "Last updated" - replace old time stamp with a new one
-"        preserving whitespace and using internal "strftime" command:
-"       requires the abbreviation  "YDATE"
-  map ,L  1G/Last update:\s*/e+1<CR>CYDATE<ESC>
-  map ,,L 1G/Last change:\s*/e+1<CR>CYDATE<ESC>
-" Example:
-" before:  "Last update:   Thu Apr  6 12:07:00 CET 1967"
-" after:   "Last update:   Tue Dec 16 12:07:00 CET 1997"
-"
-"     ,L  = "Last updated" - replace old time stamp with a new one
-"        using external "date" command (not good for all systems):
-" map ,L 1G/Last update: */e+1<CR>D:r!date<CR>kJ
-"
-" ===================================================================
-" General Editing - link to program "screen"
-" ===================================================================
-"
-"       ,Et = edit temporary file of "screen" program
-  map   ,Et :e /tmp/screen-exchange
-"       as a user of Unix systems you *must* have this program!
-"       see also:  http://www.math.fu-berlin.de/~guckes/screen/
-"
-" Email/News - Editing replies/followups
-"
-" Part 1 - prepare for editing
-"
-" Part 2 - getting rid of empty (quoted) lines and space runs.
-"
-"      ,cel = "clear empty lines"
-"       - delete the *contents* of all lines which contain only whitespace.
-"         note:  this does not delete lines!
-" map ,cel :g/^[<C-I> ]*$/d
-  map ,cel :%s/^\s\+$//
-"      ,del = "delete 'empty' lines"
-"       - delete all lines which contain only whitespace
-"         note:  this does *not* delete empty lines!
-  map ,del :g/^\s\+$/d
-"
-"      ,cqel = "clear quoted empty lines"
-"       Clears (makes empty) all lines which start with '>'
-"       and any amount of following spaces.
-" nmap ,cqel :%s/^[> ]*$//
-" vmap ,cqel  :s/^[> ]*$//
-" nmap ,cqel :%s/^[><C-I> ]\+$//
-" vmap ,cqel  :s/^[><C-I> ]\+$//
-  nmap ,cqel :%s/^[>]\+$//
-  vmap ,cqel  :s/^[><C-I> ]\+$//
-" NOTE: If the meta sequence "\s" 
-" The following do not work as "\s" is not a character
-" and thus cannot be part of a "character set".
-"  map ,cqel  :g/^[>\s]\+$/d
-"
-" Some people have strange habits within their writing.
-" But if you cannot educate them - rewrite their text!  ;-)
-"
-" Jason "triple-dots" King elephant@onaustralia.com.au
-" does uses ".." or "..." rather than the usual punctuation
-" (comma, semicolon, colon, full stop). So...
-"
-" Turning dot runs with following spaces into an end-of-sentence,
-" ie dot-space-space:
-  vmap ,dot :s/\.\+ \+/.  /g
-"
-" Gary Kline (kline@tera.tera.com) indents his
-" own text in replies with TAB or spaces.
-" Here's how to get rid of these indentation:
-  vmap ,gary :s/^>[ <C-I>]\+\([^>]\)/> \1/
-"
-"      ,ksr = "kill space runs"
-"             substitutes runs of two or more space to a single space:
-" nmap ,ksr :%s/  */ /g
-" vmap ,ksr  :s/  */ /g
-  nmap ,ksr :%s/  \+/ /g
-  vmap ,ksr  :s/  \+/ /g
-" Why can't the removal of space runs be
-" an option of "text formatting"? *hrmpf*
-"
-"    ,Sel = "squeeze empty lines"
-"    Convert blocks of empty lines (not even whitespace included)
-"    into *one* empty line (within current visual):
-   map ,Sel :g/^$/,/./-j
-"
-"    ,Sbl = "squeeze blank lines"
-"    Convert all blocks of blank lines (containing whitespace only)
-"    into *one* empty line (within current visual):
-"  map ,Sbl :g/^\s*$/,/[^ <c-i>]/-j
-"  map ,Sbl :g/^\s*$/,/[^ \t]/-j
-   map ,Sbl :g/^\s*$/,/\S/-j
-"
-" ===================================================================
-" Editing of email replies and Usenet followups - using autocommands
-" ===================================================================
-"
-" Remove ALL auto-commands.  This avoids having the
-" autocommands twice when the vimrc file is sourced again.
-"  autocmd!
-"
-" Let Vim identify itself when editing emails with Mutt:
-" au! BufNewFile mutt* let @"="X-Editor: Vim-".version." http://www.vim.org\n"|exe 'norm 1G}""P'
-"
-" set the textwidth to 70 characters for replies (email&usenet)
-"  au BufNewFile,BufRead .letter,mutt*,nn.*,snd.* set tw=78
-"
-" Try to use the mapping ",D" when doing a followup.
-" autocmd BufNewFile ~/.followup ,D|
-"
-" Part 3 - Change Quoting Level
-"
-"      ,dp = de-quote current inner paragraph
-"  map ,dp {jma}kmb:'a,'bs/^> //<CR>
-   map ,dp vip:s/^> //<CR>
-  vmap ,dp    :s/^> //<CR>
-"
-"      ,qp = quote current paragraph
-"            jump to first inner line, mark with 'a';
-"            jump to last  inner line, mark with 'b';
-"            then do the quoting as a substitution
-"            on the line range "'a,'b":
-"  map ,qp {jma}kmb:'a,'bs/^/> /<CR>
-"      vim-5 now has selection of "inner" and "all"
-"      of current text object - mapping commented!
-"
-"      ,qp = quote current paragraph (old version)
-"            jump to first inner line, Visual,
-"            jump to last  inner line,
-"            then do the quoting as a substitution:
-"  map ,qp {jV}k:s/^/> /<CR>
-"
-"      ,qp = quote current inner paragraph (works since vim-5.0q)
-"            select inner paragraph
-"            then do the quoting as a substitution:
-   map ,qp   vip:s/^/> /<CR>
-"
-"      ,qp = quote current paragraph
-"            just do the quoting as a substitution:
-  vmap ,qp    :s/^/> /<CR>
+" =============== Pathogen Initialization ===============
+" This loads all the plugins in ~/.vim/bundle
+" Use tpope's pathogen plugin to manage all other plugins
 
-"
-" Changing quote style to *the* true quote prefix string "> ":
-"
-"       Fix Supercite aka PowerQuote (Hi, Andi! :-):
-"       before ,kpq:    >   Sven> text
-"       after  ,kpq:    > > text
-"      ,kpq kill power quote
-  vmap ,kpq :s/^> *[a-zA-Z]*>/> >/<C-M>
-"
-"       Fix various other quote characters:
-"      ,fq "fix quoting"
-  vmap ,fq :s/^> \([-":}\|][ <C-I>]\)/> > /
-"
-" Part 4 - Weed Headers of quoted mail/post
-"
-" These mappings make use of the abbreviation that define a list of
-" Email headers (HEMAIL) and News headers (HNEWS):
-  nmap ,we vip:v/HEMAIL/d
-  vmap ,we    :v/HEMAIL/d
-  nmap ,wp vip:v/HNEWS/d
-  vmap ,wp    :v/HNEWS/d
-"
-" Old versions for vim-4.6:
-"      ,we = "weed email header"
-" nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
-" vmap ,we   !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
-"      ,wp = "weed post header"
-" nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
-" vmap ,wp   !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
-"
-"      ,ri = "Read in" basic lines from the email header
-"            Useful when replying to an email:
-" nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:"
-"            NOTE: "readmsg" ships with the mailer ELM.
-"
-"
-" Part 5 - Reformatting Text
-"
-"  NOTE:  The following mapping require formatoptions to include 'r'
-"    and "comments" to include "n:>" (ie "nested" comments with '>').
-"
-" Formatting the current paragraph according to
-" the current 'textwidth' with ^J (control-j):
-  imap <C-J> <c-o>gqap
-   map <C-J> gqap
-"
-"      ,b = break line in commented text (to be used on a space)
-" nmap ,b dwi<CR>> <ESC>
-  nmap ,b r<CR>
-"      ,j = join line in commented text
-"           (can be used anywhere on the line)
-" nmap ,j Jxx
-  nmap ,j Vjgq
-"
-"      ,B = break line at current position *and* join the next line
-" nmap ,B i<CR>><ESC>Jxx
-  nmap ,B r<CR>Vjgq
-"
-"      ,,, break current line at current column,
-"          inserting ellipsis and "filling space":
-" nmap ,,,  ,,1,,2
-" nmap ,,1  a...X...<ESC>FXr<CR>lmaky$o<CC-R>"<ESC>
-" nmap ,,2  :s/./ /g<C-M>3X0"yy$dd`a"yP
-"
-"
-" ===================================================================
-" Edit your reply!  (Or else!)
-" ===================================================================
-"
-" Part 6  - Inserting Special or Standard Text
-" Part 6a - The header
+  runtime bundle/tpope-vim-pathogen/autoload/pathogen.vim
+  call pathogen#infect()
+  call pathogen#helptags()
 
-"    Add adresses for To: and Cc: lines
-"
-"     ,ca = check alias (reads in expansion of alias name)
-" map ,ca :r!elmalias -f "\%v (\%n)"
-"     ,Ca = check alias (reads in expansion of alias name)
-" map ,Ca :r!elmalias -f "\%n <\%v>"
-"
-"   ,cc = "copy notice"
-"   Insert a Cc line so that person will receive a "courtesy copy";
-"   this tells the addressee that text is a copy of a public article.
-"   This assumes that there is exactly one empty line after the first
-"   paragraph and the first line of the second paragraph contains the
-"   return address with a trailing colon (which is later removed).
-  map ,cc 1G}jyykPICc: <ESC>$x
-" map ,cc ma1G}jy/ writes<CR>'aoCc: <ESC>$p
-"
-"     ,mlu = make letter urgent  (by giving the "Priority: urgent")
-  map ,mlu 1G}OPriority: urgent<ESC>
-"
-"               Fixing the From: line
-"
-"     ,cS = change Sven's address.
-  map ,cS 1G/^From: Sven Guckes/e+2<CR>C<Amailv><ESC>
-"     Used when replying as the "guy from vim".
-"
-"               Fixing the Subject line
-"
-"    Pet peeve:  Unmeaningful Subject lines.  Change them!
-"     ,cs = change Subject: line
-  map ,cs 1G/^Subject: <CR>yypIX-Old-<ESC>-W
-"    This command keeps the old Subject line in "X-Old-Subject:" -
-"    so the recipient can still search for it and
-"    you keep a copy for editing.
-"
-"
-"     ,re : Condense multiple "Re:_" to just one "Re:":
-  map ,re 1G/^Sub<CR>:s/\(Re: \)\+/Re: /<CR>
-"
-"     ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines:
-  map ,Re 1G/^Subject: <C-M>:s/Re: Re\[\([0-9]\+\)\]/Re[\1]/<C-M><C-A>
-"
-" Put parentheses around "visual text"
-"      Used when commenting out an old subject.
-"      Example:
-"      Subject: help
-"      Subject: vim - using autoindent (Re: help)
-"
-"      ,) and ,( :
-  vmap ,( v`<i(<ESC>`>a)<ESC>
-  vmap ,) v`<i(<ESC>`>a)<ESC>
-"
-" Part 6  - Inserting Special or Standard Text
-" Part 6a - Start of text - saying "hello".
-"
-"     ,hi = "Hi!"        (indicates first reply)
-  map ,hi 1G}oHi!<CR><ESC>
-"
-"     ,ha = "helloagain"  (indicates reply to reply)
-  map ,ha 1G}oHello, again!<CR><ESC>
-"
-"     ,H = "Hallo, Du!"  (German equivalent of "hi!" for replies)
-  map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
-"
-"
-" Part 6  - Inserting Special or Standard Text
-" Part 6b - End of text - dealing with "signatures".
-"
-"       remove signatures
-"
-"     ,kqs = kill quoted sig (to remove those damn sigs for replies)
-"          goto end-of-buffer, search-backwards for a quoted sigdashes
-"          line, ie "^> -- $", and delete unto end-of-paragraph:
-  map ,kqs G?^> -- $<CR>d}
-" map ,kqs G?^> *-- $<CR>dG
-"     ,kqs = kill quoted sig unto start of own signature:
-" map ,kqs G?^> *-- $<CR>d/^-- $/<C-M>
-"
-"      ,aq = "add quote"
-"            Reads in a quote from my favourite quotations:
-  nmap ,aq :r!agrep -d "^-- $" ~/.P/quotes/collection<ESC>b
-" see http://www.math.fu-berlin.de/~guckes/quotes/collection
-"
-"      ,s = "sign" -
-"           Read in signature file (requires manual completion):
-  nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS<S-Left>
-"
-" available as http://www.math.fu-berlin.de/~guckes/sig/SIGS
-"
-"      ,S = signature addition of frequently used signatures
-  nmap ,SE :r!agrep -d "^-- $" comp.mail.elm ~/.P/sig/SIGS<S-Left>
-  nmap ,SM :r!agrep -d "^-- $" WOOF ~/.P/sig/SIGS<S-Left>
-  nmap ,SV :r!agrep -d "^-- $" IMproved ~/.P/sig/SIGS<S-Left>
-"
-"      ,at = "add text" -
-"            read in text file (requires manual completion):
-  nmap ,at :r ~/.P/txt/
-"
-" MUTT: Auto-kill signatures for replies
-" map ,kqs G?^> *-- $<C-M>dG
-" autocmd BufNewFile,BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs
-"
-" At the end of editing your reply you should check your spelling
-" with the spelling checker "ispell".
-" These mappings are from Lawrence Clapp lclapp@iname.com:
-" spellcheck the document -- skip quoted text
-" nmap <F5> :w ! grep -v '^>' \| spell<CR>
-" vmap <F5> :w ! grep -v '^>' \| spell<CR>
-" At home under Linux it looks something more like this:
-" nmap <F5> :w ! grep -v '^>' \| ispell -???<CR>
-"
-"  Tell the recipient that I was replying to an old email of his:
-  ab SvenR Sven  [finally takeing the time to reply to old emails]
-"
-" Toggles:  [todo]
-"
-" toggle autoindent
-" toggle hlsearch
-" cycle textwidth between values 60, 70, 75, 80
-"
-" ===================================================================
-" HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML
-" ===================================================================
-" This has become quite big - so I moved it out to another file:
-" http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227]
-"  source ~guckes/.P/vim/source/html.vim
-"
-" ===================================================================
-" LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX
-" ===================================================================
-" This has become quite big - so I moved it out to another file:
-" http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim
-" source ~guckes/.P/vim/source/latex.vim
-"
-" ===================================================================
-" PGP - encryption and decryption
-" ===================================================================
-"
-" encrypt
-  map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty'
-" decrypt
-  map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty'
-" sign
-  map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
-  map ;v :,/^-----END/w !pgp -m
-"
-" PGP - original mappings
-"
-"       encrypt and sign (useful for mailing to someone else)
-"csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4'
-" sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4
-"
-"       sign (useful for mailing to someone else)
-"csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
-" sh: map #2 :,$! pgp -fast +clear 2>/dev/tty
-"
-"       decrypt
-"csh: map #3 :/^-----BEG/,/^-----END/!\
-"             /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4'
-" sh: map #3 :/^-----BEG/,/^-----END/!\
-"             pgp -f 2>/dev/tty^V|^V|sleep 4
-"
-"       view (pages output, like more)
-"csh: map #4 :,/^-----END/w !pgp -m
-" sh: map #4 :,/^-----END/w !pgp -m
-"
-"       encrypt alone (useful for encrypting for oneself)
-"csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4'
-" sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4
-"
-" Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says :
-" The significant feature is that stderr is redirected independently
-" of stdout, and it is redirected to /dev/tty which is a synonym for
-" the current terminal on Unix.  I don't know why the ||sleep 4
-" stuff is there, but it is harmless so I left it. Since csh is such
-" junk, special rules are used if you are using it (tcsh, too).
-" ksh and bash should use the sh form. zsh, et al: consult your
-" manual.  The #<num> format is used to map function keys. If your
-" terminal does not support the requested function key, use a
-" literal #<num>.  Not all of the clones correctly support this.
-"
-" ===================================================================
-" Useful stuff.  At least these are nice examples.  :-)
-" ===================================================================
-"
-"     ,t = transpose two characters: from aXb -> bXa
-" map ,t XplxhhPl
-" This macros shortened by one character by
-" Preben Guldberg c928400@student.dtu.dk
-" map ,t XpxphXp
-" map ,t xphXpxp
-"
-" make space move the cursor to the right - much better than a *beep*
-" nmap \  l
-"
-"     ,E = execute line
-" map ,E 0/\$<CR>w"yy$:<C-R>y<C-A>r!<C-E>
-" This command excutes a shell command from the current line and
-" reads in its output into the buffer.  It assumes that the command
-" starts with the fist word after the first '$' (the shell prompt
-" of /bin/sh).  Try ",E" on that line, ie place the cursor on it
-" and then press ",E":
-" $ ls -la
-" Note: The command line commands have been remapped to tcsh style!!
-"
-"
-"      ,dr = decode/encode rot13 text
-  vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m
+" ================ General Config ====================
 
-"       Use this with an external "rot13" script:
-"       "    ,13 - rot13 the visual text
-"       vmap ,13 :!rot13<CR>
-"
-" Give the URL under the cursor to Netscape
-" map ,net yA:!netscape -remote "openurl <C-R>""
-"
-"
-" ===================================================================
-" Mapping of special keys - arrow keys and function keys.
-" ===================================================================
-" Buffer commands (split,move,delete) -
-" this makes a little more easy to deal with buffers.
-" (works for Linux PCs in room 030)
-  map <F4>  :split<C-M>
-  map <F5>  :bp<C-M>
-  map <F6>  :bn<C-M>
-  map <F12> :bd<C-M>
-"
-" Buffer commands (split,move,delete) -
-" for Mac keyboard (Performa 5200, US keyboard)
-"
-  map <ESC>[19~ :split<C-M>
-  map <ESC>[20~ :bp<C-M>
-  map <ESC>[23~ :bn<C-M>
-  map <ESC>[31~ :bd<C-M>
-"
-" Obvious mappings
-"
-" map <PageUp>   <C-B>
-" map <PageDown> <C-F>
-"
-" Emacs style editing in insert mode
-" This is something I tried for a minute
-" and forgot about the minute after. ;-)
-"
-" imap <C-A>  <ESC>0i
-" imap <C-B>  <ESC>hi
-" imap <C-D>  <ESC>xi
-" imap <C-E>  <ESC>A
-" imap <C-F>  <ESC>lli
-" imap <C-N>  <ESC>jli
-" imap <C-P>  <ESC>kli
-" imap <ESC>b <ESC>bi
-" imap <ESC>f <ESC>lWi
-"
-" Normal mode - tcsh style movements [960425]
-"
-" nmap <C-A>  0
-" nmap <C-B>  h
-" nmap <C-D>  x
-" nmap <C-E>  $
-" nmap <C-F>  l
-" nmap <ESC>b b
-" nmap <ESC>f w
-"
-" DOS keyboard mapping for cursor keys
-"
-"  map <ESC>[A <Up>
-"  map <ESC>[B <Down>
-"  map <ESC>[C <Right>
-"  map <ESC>[D <Left>
-" imap <ESC>[A <Up>
-" imap <ESC>[B <Down>
-" imap <ESC>[C <Right>
-" imap <ESC>[D <Left>
-"
-" DOS keyboard
-" "insert"
-"  map <ESC>[1~ i
-"  map <ESC>[1~ <insert>
-" "home"
-"  map <ESC>[2~ ^
-"  map <ESC>[2~ 0
-"  map <ESC>[2~ <Home>
-" "pgup"
-"  map <ESC>[3~ <C-B>
-"  map <ESC>[3~ <PageUp>
-" "delete"
-"  map <ESC>[4~ x
-"  map <ESC>[4~ <Del>
-" "end"
-"  map <ESC>[5~ $
-"  map <ESC>[5~ <END>
-" "pgdn"
-"  map <ESC>[6~ <C-F>
-"  map <ESC>[6~ <PageDown>
-"
-" Keyboard mapping for cursor keys
-" [works for SUNs in Solarium (room 030) - 970815]
-"
-   map <ESC>OA <Up>
-   map <ESC>OB <Down>
-   map <ESC>OC <Right>
-   map <ESC>OD <Left>
-  imap <ESC>OA <Up>
-  imap <ESC>OB <Down>
-  imap <ESC>OC <Right>
-  imap <ESC>OD <Left>
-"
-" Keyboard mapping for cursor keys
-" [works for XTerminals - 970818]
-   map <ESC>[A <Up>
-   map <ESC>[B <Down>
-   map <ESC>[C <Right>
-   map <ESC>[D <Left>
-  imap <ESC>[A <Up>
-  imap <ESC>[B <Down>
-  imap <ESC>[C <Right>
-  imap <ESC>[D <Left>
-"
-" ===================================================================
-" AutoCommands
-" ===================================================================
-"
-" Autocommands are the key to "syntax coloring".
-" There's one command in your vimrc that should
-" load/source the file $VIM/syntax/syntax.vim
-" which contains the definition for colors and
-" the autocommands that load other syntax files
-" when necessary, ie when the filename matches
-" a given pattern, eg "*.c" or *".html".
-"
-" just load the main syntax file when Vim was compiled with "+syntax"
-  if has("syntax")
-    " define my own syntax file (to be sourced t the end of syntax.vim):
-    " let mysyntaxfile="~guckes/.P/vim/syntax/syntax.vim"
-    " URL: http://www.math.fu-berlin.de/~guckes/vim/syntax/syntax.vim
-    " The main/standard syntax file:
-      so $VIMRUNTIME/syntax/syntax.vim
-    "
-    " Use my own syntax file on "mail/news messages":
-      let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES
-"     exe aucommand." source ~guckes/.P/vim/syntax/sven.vim"
-    "
-      hi! Comment  term=bold  ctermfg=cyan  guifg=Blue
-  endif
-"
-"
-" EXAMPLE: Restricting mappings to some files only:
-" An autocommand does the macthign on the filenames -
-" but abbreviations are not expanded within autocommands.
-" Workaround:  Use "exe" for expansion:
-" let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES
-" exe aucommand." :map ,hi 1G}oHi!<CR><ESC>"
-" exe aucommand." :map ,ha 1G}oHello, again!<CR><ESC>"
-" exe aucommand." :map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>"
-" exe aucommand." :map ,re 1G}oRe!<CR><ESC>"
-"
-" Automatically place the cursor onto the first line of the mail body:
-" autocmd BufNewFile,BufRead MAILNEWSFILES :normal 1G}j
-"
-" Toggle syntax coloring on/off with "__":
-" nn __ mg:if has("syntax_items")<Bar>syn clear<CR>else<Bar>syn on<CR>en<CR>`g
-" Note:  It works - but the screen flashes are quite annoying.  :-/
-"
-"
-" ===================================================================
-" EXAMPLES
-" ===================================================================
-"
-" Visualizing trailing whitespace:
-" :set hls
-" /\s\+$
-"
-" Toggling a numerical variable between two values.
-" Example:  Switch the textwidth (tw) between values "70" and "80":
-" map \1 :let &tw = 150 - &tw<CR>
-"
-" Capitalizing the previously typed word,
-" returning to the previous position:
-" imap CAP <ESC>mzB~`za
-"
-" Uppercasing the previously typed word,
-" returning to the previous position:
-" imap CAP <ESC>mzvBU`za
-" imap CAP <ESC>mzBvaWU`za
-"
-" ===================================================================
-" TEMPORARY STUFF - TESTING THINGS
-" ===================================================================
-"
-"   View a html document (or part of it) with lynx. You need
-"   a system that supports the /def/fd/* file descriptors :-(
-"nmap ,ly :w !lynx -force_html /dev/fd/0<CR>
-"vmap ,ly :w !lynx -force_html /dev/fd/0<CR>
-"
-" Fri Jun 19 19:19:19 CEST 1998
-" Hi, Vikas! vikasa@att.com
-" The <Left> key produces the code "<Esc>OD" and Vikas wants to make
-" Vim jump back one word in normal mode, ie using the command 'b':
-" nmap <Esc>OD b
-" Works for me!  :-)
-"
-" Some simple example of the "expand modifiers":
-" insert the current filename *with* path:
-  iab YPATHFILE <C-R>=expand("%:p")<cr>
-" insert the current filename *without* path:
-  iab YFILE <C-R>=expand("%:t:r")<cr>
-" insert the path of current file:
-  iab YPATH <C-R>=expand("%:h")<cr>
-"
-"     #b = "browse" - send selected URL to Netscape
- vmap #b y:!netscape -remote "openurl <C-R>""
-"
-" Toggle highlight search and report the current value:
-" map #1 :set hls!<cr>
-" map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3)<cr>
-" map ## #1#2
-"
-" Sorting current line containing a list of numbers
-" map ## :s/ /<C-M>/g<CR>vip!sort -n
-"
-" Replying to the mutt mailing list:
-" Remove header lines Cc: and Bcc: and insert [mutt] at the beginning
-" map ,MM 1G/^Cc:<CR>2dd}o[mutt]<CR>
-"
-" map ,U %s#<URL:\(.*\)>#<a href="\1"></a>#gc
-" map ,F {jma}kmb:'a,'b!sed -e "s/^>//"<C-V><C-V>|\
-"        sed -f ~/.P/elm/scripts/weedout.sed
-" map ,mb ebi<CR><b><ESC>Ea</b><CR><ESC>dw
-"
-" stripping netscape bookmarks and making them list items
-" vmap ,ns :.,$s/^ *<DT><\(A.*"\) ADD.*">\(.*\)$/<li> <\1><C-M><C-I>\2/
-"
-" Jump to the last space before the 80th column.
-" map ,\| 80\|F 
-"
-" extracting variable names from mutt's init.c
-" :%s/^.*"\([a-z0-9_]*\)".*$/\1/
-"
-"     \<> = change to <> notation by substituting ^M and ^[
-" cab \<> s/<C-V><ESC>/<ESC>/gc<C-M>:s/<C-V><C-M>/<C-M>/gc<C-M>
-"
-" Changing the From_ line in pseudo mail folders to an appropriate
-"  value - so you can read them with a mailer.
-" %s/^From /From guckes Thu Apr  6 12:07:00 1967/
-"
-" ===================================================================
-" ASCII tables - you may need them some day.  Save them to a file!
-" ===================================================================
-"
-" ASCII Table - | octal value - name/char |
-"
-" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
-" |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si |
-" |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb|
-" |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us |
-" |040 sp |041  ! |042  " |043  # |044  $ |045  % |046  & |047  ' |
-" |050  ( |051  ) |052  * |053  + |054  , |055  - |056  . |057  / |
-" |060  0 |061  1 |062  2 |063  3 |064  4 |065  5 |066  6 |067  7 |
-" |070  8 |071  9 |072  : |073  ; |074  < |075  = |076  > |077  ? |
-" |100  @ |101  A |102  B |103  C |104  D |105  E |106  F |107  G |
-" |110  H |111  I |112  J |113  K |114  L |115  M |116  N |117  O |
-" |120  P |121  Q |122  R |123  S |124  T |125  U |126  V |127  W |
-" |130  X |131  Y |132  Z |133  [ |134  \ |135  ] |136  ^ |137  _ |
-" |140  ` |141  a |142  b |143  c |144  d |145  e |146  f |147  g |
-" |150  h |151  i |152  j |153  k |154  l |155  m |156  n |157  o |
-" |160  p |161  q |162  r |163  s |164  t |165  u |166  v |167  w |
-" |170  x |171  y |172  z |173  { |174  | |175  } |176  ~ |177 del|
-"
-" ===================================================================
-" ASCII Table - | decimal value - name/char |
-"
-" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
-" |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si |
-" |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb|
-" |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us |
-" |032 sp |033  ! |034  " |035  # |036  $ |037  % |038  & |039  ' |
-" |040  ( |041  ) |042  * |043  + |044  , |045  - |046  . |047  / |
-" |048  0 |049  1 |050  2 |051  3 |052  4 |053  5 |054  6 |055  7 |
-" |056  8 |057  9 |058  : |059  ; |060  < |061  = |062  > |063  ? |
-" |064  @ |065  A |066  B |067  C |068  D |069  E |070  F |071  G |
-" |072  H |073  I |074  J |075  K |076  L |077  M |078  N |079  O |
-" |080  P |081  Q |082  R |083  S |084  T |085  U |086  V |087  W |
-" |088  X |089  Y |090  Z |091  [ |092  \ |093  ] |094  ^ |095  _ |
-" |096  ` |097  a |098  b |099  c |100  d |101  e |102  f |103  g |
-" |104  h |105  i |106  j |107  k |108  l |109  m |110  n |111  o |
-" |112  p |113  q |114  r |115  s |116  t |117  u |118  v |119  w |
-" |120  x |121  y |122  z |123  { |124  | |125  } |126  ~ |127 del|
-"
-" ===================================================================
-" ASCII Table - | hex value - name/char |
-"
-" | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel|
-" | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si |
-" | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb|
-" | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us |
-" | 20 sp | 21  ! | 22  " | 23  # | 24  $ | 25  % | 26  & | 27  ' |
-" | 28  ( | 29  ) | 2a  * | 2b  + | 2c  , | 2d  - | 2e  . | 2f  / |
-" | 30  0 | 31  1 | 32  2 | 33  3 | 34  4 | 35  5 | 36  6 | 37  7 |
-" | 38  8 | 39  9 | 3a  : | 3b  ; | 3c  < | 3d  = | 3e  > | 3f  ? |
-" | 40  @ | 41  A | 42  B | 43  C | 44  D | 45  E | 46  F | 47  G |
-" | 48  H | 49  I | 4a  J | 4b  K | 4c  L | 4d  M | 4e  N | 4f  O |
-" | 50  P | 51  Q | 52  R | 53  S | 54  T | 55  U | 56  V | 57  W |
-" | 58  X | 59  Y | 5a  Z | 5b  [ | 5c  \ | 5d  ] | 5e  ^ | 5f  _ |
-" | 60  ` | 61  a | 62  b | 63  c | 64  d | 65  e | 66  f | 67  g |
-" | 68  h | 69  i | 6a  j | 6b  k | 6c  l | 6d  m | 6e  n | 6f  o |
-" | 70  p | 71  q | 72  r | 73  s | 74  t | 75  u | 76  v | 77  w |
-" | 78  x | 79  y | 7a  z | 7b  { | 7c  | | 7d  } | 7e  ~ | 7f del|
-" ===================================================================
-"
-" ===================================================================
-" If your read this...
-" ===================================================================
-" ... then please send me an email!  Thanks!  --Sven guckes@vim.org
-" I have received some emails so far - thanks, folks!
-" Enjoy Vim!  :-)
-" ===================================================================
-" Yet another example for an autocommand:  [980616]
-"  au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!"
-" ===================================================================
-" Last but not least...
-" =====================================================
-" The last line is allowed to be a "modeline" with my setup.
-" It gives vim commands for setting variable values that are
-" specific for editing this file.  Used mostly for setting
-" the textwidth (tw) and the "shiftwidth" (sw).
-" Note that the colon within the value of "comments" needs to
-" be escaped with a backslash!  (Thanks, Thomas!)
-"       vim:tw=70 et sw=4 comments=\:\"
+set number                      "Line numbers are good
+set backspace=indent,eol,start  "Allow backspace in insert mode
+set history=1000                "Store lots of :cmdline history
+set showcmd                     "Show incomplete cmds down the bottom
+set showmode                    "Show current mode down the bottom
+set gcr=a:blinkon0              "Disable cursor blink
+set visualbell                  "No sounds
+set autoread                    "Reload files changed outside vim
 
-hi Normal guibg=#000000 guifg=#FFFFFF
-set sw=2 ts=2 tw=0 wm=0 nowrap cindent
-set shellpipe=2>
-set comments=sr:/**,m:*\ ,e:*/,://,b:#,:%,:XCOMM,n:>,n:\:,fb:-
+" This makes vim act like all other editors, buffers can
+" exist in the background without being in a window.
+" http://items.sjbach.com/319/configuring-vim-right
+" set hidden
 
-augroup Perl
-	autocmd!
-  autocmd  BufEnter *.pl set sw=2 ts=2 tw=0 wm=0 nowrap si
-augroup END
+"turn on syntax highlighting
+syntax on
 
-augroup Email
-	autocmd!
-	autocmd  BufEnter /var/tmp/pico.* set tw=70
-augroup END
+" ================ Search Settings  =================
 
-set expandtab
-set tabstop=4
+set incsearch        "Find the next match as we type the search
+set hlsearch         "Hilight searches by default
+set viminfo='100,f1  "Save up to 100 marks, enable capital marks
+
+" ================ Turn Off Swap Files ==============
+
+set noswapfile
+set nobackup
+set nowb
+
+" ================ Persistent Undo ==================
+" Keep undo history across sessions, by storing in file.
+" Only works all the time.
+
+silent !mkdir ~/.vim/backups > /dev/null 2>&1
+set undodir=~/.vim/backups
+set undofile
+
+" ================ Indentation ======================
+
+set autoindent
+set smartindent
+set smarttab
 set shiftwidth=4
+set tabstop=4
+set expandtab
+
+filetype plugin on
+filetype indent on
+
+" Display tabs and trailing spaces visually
+set list listchars=tab:\ \ ,trail:·
+
+set nowrap       "Don't wrap lines
+set linebreak    "Wrap lines at convenient points
+
+" ================ Folds ============================
+
+set foldmethod=indent   "fold based on indent
+set foldnestmax=3       "deepest fold is 3 levels
+set nofoldenable        "dont fold by default
+
+" ================ Completion =======================
+
+set wildmode=list:longest
+set wildmenu                "enable ctrl-n and ctrl-p to scroll thru matches
+set wildignore=*.o,*.obj,*~ "stuff to ignore when tab completing
+set wildignore+=*vim/backups*
+set wildignore+=*sass-cache*
+set wildignore+=*DS_Store*
+set wildignore+=vendor/rails/**
+set wildignore+=vendor/cache/**
+set wildignore+=*.gem
+set wildignore+=log/**
+set wildignore+=tmp/**
+set wildignore+=*.png,*.jpg,*.gif
+
+"
+
+" ================ Scrolling ========================
+
+set scrolloff=8         "Start scrolling when we're 8 lines away from margins
+set sidescrolloff=15
+set sidescroll=1
+
+" ================ Customization ========================
+set background=dark
+set modeline
+set modelines=1
+set ruler
+set laststatus=2